- SynonymEGFRvIII
- SourceBiotinylated Human EGFRvIII, Avitag,His Tag (EGR-H82E0) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Ser 378 (Accession # NP_001333870.1).Predicted N-terminus: Leu 25Request for sequence
- Molecular Characterization
This protein carries an Avi tag (Avitag™) at the C-terminus, followed by a polyhistidine tag.
The protein has a calculated MW of 42.2 kDa. The protein migrates as 60-90 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.
- BiotinylationBiotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.
- Biotin:Protein RatioThe biotin to protein ratio is 0.5-1 as determined by the HABA assay.
- EndotoxinLess than 1.0 EU per μg by the LAL method.
- Purity
>95% as determined by SDS-PAGE.
>90% as determined by SEC-MALS.
- Formulation
Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.
Contact us for customized product form or formulation.
- Reconstitution
Please see Certificate of Analysis for specific instructions.
For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.
- Storage
For long term storage, the product should be stored at lyophilized state at -20°C or lower.
Please avoid repeated freeze-thaw cycles.
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
Biotinylated Human EGFRvIII, Avitag,His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
The purity of Biotinylated Human EGFRvIII, Avitag,His Tag (Cat. No. EGR-H82E0) was more than 90% and the molecular weight of this protein is around 60-70 kDa verified by SEC-MALS.
Immobilized Biotinylated Human EGFRvIII, Avitag,His Tag (Cat. No. EGR-H82E0) at 1 μg/mL (100 μL/well) on streptavidin (Cat. No. STN-N5116) precoated (0.5 μg/well) plate, can bind Anti-EGFRvIII Antibody , Human IgG1 with a linear range of 0.1-3 ng/mL (QC tested).
Immobilized CetuxiMab at 1 μg/mL (100 μL/well) can bind Biotinylated Human EGFRvIII, Avitag,His Tag (Cat. No. EGR-H82E0) with a linear range of 0.2-2 ng/mL (Routinely tested).
- Citations
Small-molecule probes for affinity-guided introduction of biocom-patible handles on metal-binding proteins
Authors: Mortensen MR, et al.
Journal: Bioconjug Chem 2018
Application: SPR
Request for Full-text
- Amino Acid Sequence
LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH
- BackgroundThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer.The type III EGF deletion-mutant receptor (EGFRvIII) is the most common mutation and was first identified in primary human glioblastoma tumors; EGFR gene amplification is correlated with the structural rearrangement of the gene. The EGFRvIII gene has an in-frame deletion of 801 base pairs, corresponding to exons 2–7 in the mRNA, resulting in the deletion of amino acids 30-297 in the extracellular domain and the generation of a glycine at the fusion point.
- References
Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.
