Product Name | Beta - Amyloid (11 - 40), HumanEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Size | 1 mg |
Catalog # | AS-60017-1 |
US$ | $397 |
Purity | % Peak Area By HPLC ≥ 95% |
Post-mortem Alzheimers diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Huse, JT. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002). |
Molecular Weight | 3151.7 |
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | |
Sequence(Three-Letter Code) | H - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |