Product Name | SecretoneurinTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
Size | 1 mg |
Catalog # | AS-62673 |
US$ | $295 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Kirchmair R, et al. Neurosci. 53, 359 (1993); Kirchmair R, et al. Circulation 110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom. 5, 998 (2006). |
Molecular Weight | 3652.0 |
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ | |
Sequence(Three-Letter Code) | H - Thr - Asn - Glu - Ile - Val - Glu - Glu - Gln - Tyr - Thr - Pro - Gln - Ser - Leu - Ala - Thr - Leu - Glu - Ser - Val - Phe - Gln - Glu - Leu - Gly - Lys - Leu - Thr - Gly - Pro - Ser - Asn - Gln - OH |
Product Citations | Meyer, RC. et al. (2013). GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin. Proc Natl Acad Sci 110, 9529. doi: 10.1073/pnas.1219004110. |