Product Name | SHLP3 (Small humanin - like peptide 3)H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH |
Size | 0.1 mg |
Catalog # | AS-65589 |
US$ | $122 |
Purity | % Peak Area By HPLC ≥ 95% |
Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2 | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | 1. Cobb L. J. et al., AGING 8 (4), 796-808 (2016). 2. Okada A. K. et al., Sci Reports 7 (7802), 1-10 (2017). . |
Molecular Weight | 4380.4 |
H-MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW-OH | |
Sequence(Three-Letter Code) | NH2 - Met - Leu - Gly - Tyr - Asn - Phe - Ser - Ser - Phe - Pro - Cys - Gly - Thr - Ile - Ser - Ile -Ala - Pro - Gly - Phe - Asn - Phe - Tyr - Arg - Leu - Tyr - Phe - Ile - Trp - Val - Asn - Gly - Leu -Ala - Lys - Val - Val - Trp - COOH |