Product Name | GIP (1 - 42), humanYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Size | 0.5 mg |
Catalog # | AS-61226-05 |
US$ | $160 |
Purity | % Peak Area By HPLC ≥ 95% |
GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Brown, JC & JR Dryburgh Can J Biochem 49, 867 (1971), doi: 10.1139/o71-122 Buchan, MT. et al. Histochem 56, 37Dupre, J. et al. J Clin Endocrinol Metab 37, 826 (1973), doi: http://dx.doi.org/10.1210/jcem-37-5-826 Getty-Kaushik, L. et al. Obesity 14, 1124, doi: 10.1038/oby.2006.129 |
Molecular Weight | 4983.6 |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | |
Sequence(Three-Letter Code) | H - Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH |