Product Name | [Cys(HiLyteᵀᴹFluor 647 C2 maleimide)] - Exendin - 4C(HiLyteFluor 647 C2 maleimide) - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2 |
Size | 50 ug |
Catalog # | AS-63714 |
US$ | $118 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide is HiLyte Fluor 647 labeled Extendin-4 (Ex/Em=650 nm/675 nm).A cysteine residue has been added to the peptide N-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1(GLP-1) receptor, induces release of insulin after food intake.Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993) |
Molecular Weight | 5486.3 |
C(HiLyte Fluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | |
Sequence(Three-Letter Code) | H - Cys(Hilyte Fluor 647 C2 maleimide) - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |