Product Name | Calcitonin, salmonCSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7) |
Size | 5 mg |
Catalog # | AS-20678 |
US$ | $494 |
Purity | % Peak Area By HPLC ≥ 95% |
A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Andreotti, G. et al. J Biol Chem 281, 24193 (2006), doi: 10.1074/jbc.M603528200 |
Molecular Weight | 3431.9 |
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7) | |
Sequence(Three-Letter Code) | H - Cys - Ser - Asn - Leu - Ser - Thr - Cys - Val - Leu - Gly - Lys - Leu - Ser - Gln - Glu - Leu - His - Lys - Leu - Gln - Thr - Tyr - Pro - Arg - Thr - Asn - Thr - Gly - Ser - Gly - Thr - Pro - NH2 (Disulfide bridge: 1 - 7) |