Product Name | Calcitonin, humanCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7) |
Size | 5 mg |
Catalog # | AS-20674 |
US$ | $589 |
Purity | % Peak Area By HPLC ≥ 95% |
Human calcitonin stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget"s disease. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Raddino, R. et al. J. Cardiovas. Pharmacol. 29, 463 (1997); Rotella, C. et al. Eur. J. Pharmacol. 107, 347 (1985); Moriarty, et al. Biochem Biophys Res. Commun. 245, 344 (1998); Chen, W. et al. Mol. Pharmacol. 52, 1164 (1997). |
Molecular Weight | 3417.9 |
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7) | |
Sequence(Three-Letter Code) | H - Cys - Gly - Asn - Leu - Ser - Thr - Cys - Met - Leu - Gly - Thr - Tyr - Thr - Gln - Asp - Phe - Asn - Lys - Phe - His - Thr - Phe - Pro - Gln - Thr - Ala - Ile - Gly - Val - Gly - Ala - Pro - NH2 (Disulfide bridge: 1 - 7) |
Product Citations | Takiyama, K. et al. (2009). A Phos-tag-based fluorescence resonance energy transfer system for the analysis of the dephosphorylation of phosphopeptides. Anal Biochem 388, 235. |