| Tested Species Reactivity | Fruit fly |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-10522 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Complete computational species homology data | Anti-cad (ARP47825_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-cad (ARP47825_P050) antibody is Catalog # AAP47825 (Previous Catalog # AAPS19005) |
| Datasheets/Manuals | Printable datasheet for anti-cad (ARP47825_P050) antibody |
| Gene Symbol | cad |
|---|---|
| Official Gene Full Name | Caudal |
| Alias Symbols | Dmel_CG1759, 38E.19, CG1759, Cad, S67, cd, anon-WO2004063362.83, CAD, DmelCG1759 |
| NCBI Gene Id | 35341 |
| Protein Name | Homeotic protein caudal |
| Description of Target | Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg). |
| Swissprot Id | P09085 |
| Protein Accession # | NP_599128 |
| Nucleotide Accession # | NM_134301 |
| Protein Size (# AA) | 427 |
| Molecular Weight | 46kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express cad.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express cad.  |
| Protein Interactions | CG1418; CG32647; CG34168; CkIIalpha; RpS7; CG31140; lsn; CG10032; CG6933; Cp16; CG2199; Khc; CG15706; CG13339; Ef1alpha48D; CG14764; noc; CG44774; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
- Reviewed Data:
- Product Protocols: cad antibody tested with Human Drosophila(ARP47825_P050)
What is the species homology for "cad Antibody - middle region (ARP47825_P050)"?
The tested species reactivity for this item is "Fruit fly". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".
How long will it take to receive "cad Antibody - middle region (ARP47825_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
What buffer format is "cad Antibody - middle region (ARP47825_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "cad Antibody - middle region (ARP47825_P050)"?
This target may also be called "Dmel_CG1759, 38E.19, CG1759, Cad, S67, cd, anon-WO2004063362.83, CAD, DmelCG1759" in publications.
What is the shipping cost for "cad Antibody - middle region (ARP47825_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "cad Antibody - middle region (ARP47825_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "cad Antibody - middle region (ARP47825_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "46kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "cad Antibody - middle region (ARP47825_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "CAD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "CAD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "CAD"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "CAD"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "CAD"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "CAD"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
