

ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.
Description:
AA sequence: CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM-NH2
Disulfide bridges: C1-C21; C8-C25; C20-C40
Length (aa): 41
Formula: C171H285N61O53S9
Molecular weight: 4331,74 g/mol
Appearance: White lyophilized solid
Solubility: water and saline buffer
CAS number:
Source: Synthetic
Purity rate: > 95 %
Reference:
ω-Tbo-IT1–New Inhibitor of Insect Calcium Channels Isolated from Spider Venom
Mikov A., et al. (2015) ω-Tbo-IT1–New Inhibitor of Insect Calcium Channels Isolated from Spider Venom. Sci Rep.
Novel disulfide-containing polypeptide toxin was discovered in the venom of the Tibellus oblongus spider. We report on isolation, spatial structure determination and electrophysiological characterization of this 41-residue toxin, called ω-Tbo-IT1. It has an insect-toxic effect with LD50 19 μg/g in experiments on house fly Musca domestica larvae and with LD50 20 μg/g on juvenile.
PMC: 4661699