

Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
>70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Specifications:
Target |
![]() |
GluA2/GluR2 glutamate receptor |
![]() |
||
Applications |
![]() |
Immunoblot (IB) Immuno-gold EM Immunohistochemistry (IHC) |
![]() |
||
Clone |
![]() |
L21/32 |
![]() |
||
IgG Isotype |
![]() |
IgG1 |
![]() |
||
Species Reactivity |
![]() |
Human (H) Mouse (M) Rat (R) |
![]() |
||
Validation |
![]() |
Br-IB Br-IHC KO T |
![]() |
||
Type |
![]() |
Purified |
![]() |
||
Format |
![]() |
100 ul |
![]() |
||
Cross Reactivity |
![]() |
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results) |
![]() |
||
Expected Banding Pattern |
![]() |
90 kDa |
![]() |
||
Host |
![]() |
Mouse (M) |
![]() |
||
Label |
![]() |
Unlabeled |
![]() |
||
Antibody Type |
![]() |
Monoclonal |
![]() |
||
Commercial Price |
![]() |
450 |
![]() |
||
Non-Profit Price |
![]() |
200 |
![]() |
||
Distributor Price |
![]() |
Per Contract(QUOTE) |
![]() |
||
ABID |
![]() |
RRID:AB_2232661 |
![]() |