Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
>70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Specifications:
Target |
GluA2/GluR2 glutamate receptor | |
Applications |
Immunoblot (IB) Immuno-gold EM Immunohistochemistry (IHC) |
|
Clone |
L21/32 | |
IgG Isotype |
IgG1 | |
Species Reactivity |
Human (H) Mouse (M) Rat (R) |
|
Validation |
Br-IB Br-IHC KO T |
|
Type |
Purified | |
Format |
100 ul | |
Cross Reactivity |
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results) | |
Expected Banding Pattern |
90 kDa | |
Host |
Mouse (M) | |
Label |
Unlabeled | |
Antibody Type |
Monoclonal | |
Commercial Price |
450 | |
Non-Profit Price |
200 | |
Distributor Price |
Per Contract(QUOTE) | |
ABID |
RRID:AB_2232661 | |