- SynonymRP1-261G23.1,MGC70609,MVCD1,VEGFA,VPF
- SourceActiveMax® Human VEGF110, Tag Free (HPLC-verified) (VE0-H5212) is expressed from human 293 cells (HEK293). It contains AA Ala 27 - Arg 136 (Accession # NP_001165097).Predicted N-terminus: Ala 27Request for sequence
- Molecular Characterization
This protein carries no "tag".
The protein has a calculated MW of 12.7 kDa. The protein migrates as 18-20 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation.
This product does not contain a heparin binding domain, and therefore doesn"t bind with heparin.
- EndotoxinLess than 1.0 EU per μg by the LAL method.
- Purity
>95% as determined by SDS-PAGE.
>95% as determined by SEC-HPLC.
- Formulation
Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.
Contact us for customized product form or formulation.
- Reconstitution
Please see Certificate of Analysis for specific instructions.
For best performance, we strongly recommend you to follow the reconstitution protocol provided in the CoA.
- Storage
For long term storage, the product should be stored at lyophilized state at -20°C or lower.
Please avoid repeated freeze-thaw cycles.
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
ActiveMax® Human VEGF110, Tag Free (HPLC-verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
The purity of ActiveMax® Human VEGF110, Tag Free (HPLC-verified) (Cat. No. VE0-H5212) was greater than 95% as determined by SEC-HPLC.
Immobilized ActiveMax® Human VEGF110, Tag Free (HPLC-verified) (Cat. No. VE0-H5212) at 0.05 μg/mL (100 μL/well) can bind Human VEGF R1, His Tag (Cat. No. VE1-H5220) with a linear range of 4-63 ng/mL (QC tested).
ActiveMax® Human VEGF110, Tag Free (HPLC-verified) (Cat. No. VE0-H5212) stimulates proliferation of human umbilical vein endothelial cells (HUVEC). The EC50 for this effect is 5.06-11.59 ng/mL (Routinely tested).
ActiveMax® Human VEGF110, Tag Free (HPLC-verified) (Cat. No. VE0-H5212) stimulates proliferation of human umbilical vein endothelial cells (HUVEC). The EC50 for this effect is 5.06-11.59 ng/mL (Routinely tested).
- Amino Acid Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR
- BackgroundVascular endothelial growth factor (VEGF), also known as vascular permeability factor (VPF) and VEGF-A, andis a member of the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. Alternatively spliced isoforms of 110,121,145,165,183,189 and 206 amino acids in length are expressed in humans.
- References
- (1)Takahashi, H. and Shibuya, M., 2005, Clin Sci (Lond) 109, 227-41.
- (2)Neufeld, G. et al., 1999, FASEB J 13, 9-22.
- (3)Robinson, C.J. and Stringer, S.E., 2001, J Cell Sci 114, 853-65.
Please contact us via TechSupport@acrobiosystems.com if you have any question on this product.