Product Name | PACAP (6 - 38), amide, human, ovine, ratFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2 |
Size | 0.5 mg |
Catalog # | AS-22516 |
US$ | $176 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Robberecht, P. et al. Eur. J. Biochem. 207, 239 (1992). |
Molecular Weight | 4024.8 |
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 | |
Sequence(Three-Letter Code) | H - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2 |