Product Name | Beta - Amyloid (1 - 40), FAM - labeled, HumanFAM - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Size | 0.1 mg |
Catalog # | AS-23514-01 |
US$ | $139 |
Purity | % Peak Area By HPLC ≥ 95% |
This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Prior, R. et al. Am. J. Pathol. 148, 1749 (1996). |
Molecular Weight | 4688.2 |
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | |
Sequence(Three-Letter Code) | FAM - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |
Product Citations | Song, E. et al. (2011). Mixed dimers of insulin degrading enzyme reveal a Cis activation mechanism. J Biol Chem doi: 10.1074/jbc.M110.191668.Behl, M. et al. (2010). Lead-induced accumulation of β-amyloid in the choroid plexus: Role of low density lipoprotein receptor protein-1 and protein kinase C. NeuroToxicol doi:10.1016/j.neuro.2010.05.004.Huang, WC. et al. (2009). Enlargement of Aβ aggregates through chemokine-dependent microglial clustering. Neurosci. Res. 63, 280.Wakabayashi, M. et al. (2007). Formation of Amyloids by Aβ-(142) on NGF-differentiated PC12 Cells: Roles of Gangliosides and Cholesterol. J. Mol. Biol. 371, 924. |