Product Name | Peptide YY (3 - 36), humanIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2 |
Size | 0.5 mg |
Catalog # | AS-24405 |
US$ | $147 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Grandt, D. et al. Regul. Peptides 40, 161 (1992); Batterham, R. et al. Nature. 418, 650 (2002). |
Molecular Weight | 4049.5 |
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 | |
Sequence(Three-Letter Code) | H - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2 |
Product Citations | Adams, Sean H. et al. Endocrinology. 145, 4967 (2004). |