| Product Name | Glucagon - Like Peptide 1, GLP - 1 (7 - 37)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Size | 0.5 mg |
| Catalog # | AS-20761 |
| US$ | $159 |
| Purity | % Peak Area By HPLC ≥ 95% |
GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) andGLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated. | |
| Detailed Information | |
| Storage | -20°C |
| References | Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002)Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001)Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004)Rothstein, JD. et al. Neuron 16, 675 (1996) |
| Molecular Weight | 3355.7 |
| HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | |
| Sequence(Three-Letter Code) | H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH |


