Product Name | Des - gamma - carboxylated Osteocalcin/Bone Gla ProteinYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23 - 29) |
Size | 0.25 mg |
Catalog # | AS-65307-025 |
US$ | $180 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Houben, R. et al. Biochem J 364, 323 (2002); Ducy, P. et al. Nature 382, 448 (1996); Benton, ME. et al. Biochem 37, 13262 (1995); Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991); Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985). |
Molecular Weight | 5797.5 |
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29) | |
Sequence(Three-Letter Code) | H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - Arg - Arg - Phe - Tyr - Gly - Pro - Val - OH (Disulfide bridge:C23 - 29) |