

Product Name | GIP (3 - 42), humanEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Size | 1 mg |
Catalog # | AS-61227 |
US$ | $368 |
Purity | % Peak Area By HPLC ≥ 95% |
This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor. | |
Detailed Information | ![]() ![]() |
Storage | -20°C |
References | Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525 |
Molecular Weight | 4759.4 |
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ | |
Sequence(Three-Letter Code) | H - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH |