Product Name | HNP - 1, Defensin Human Neutrophil Peptide - 1ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29) |
Size | 0.1 mg |
Catalog # | AS-60743 |
US$ | $208 |
Purity | % Peak Area By HPLC ≥ 95% |
Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Frick, I. et al. J. Biol. Chem. 278, 16561 (2003); Valore, E. at al. J. Clin. Invest. 97, 1624 (1996); Mizukawa, N. et al. Anticancer Res. 20, 1125 (2000); Bastian, A. and H. Schafer, Regul Pept. 101, 157 (2001). |
Molecular Weight | 3442.1 |
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29) | |
Sequence(Three-Letter Code) | H - Ala - Cys - Tyr - Cys - Arg - Ile - Pro - Ala - Cys - Ile - Ala - Gly - Glu - Arg - Arg - Tyr - Gly - Thr - Cys - Ile - Tyr - Gln - Gly - Arg - Leu - Trp - Ala - Phe - Cys - Cys - OH (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29) |
Product Citations | Hou, S. et al. (2015). Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37 ASM 83 doi: 10.1128/IAI.00746-15 Swidergall, M. et al. (2013). Candida albicans mucin Msb2 Is a broad-tange protectant against antimicrobial peptides. Antimicrob Agents Chemother 57, 3917. doi: 10.1128/AAC.00862-13.Vega, LA. et al. (2012). Cationic antimicrobial peptides disrupt the Streptococcus pyogenes ExPortal. Mol Microbiol 85, 1119. doi: 10.1111/j.1365-2958.2012.08163.x (2012).Laing, S. et al. (2011). Strategies for the identification of arginine ADP-ribosylation sites. J Proteomics 75, 169. |