Product Name | Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2 |
Size | 1 mg |
Catalog # | AS-24010 |
US$ | $300 |
Purity | % Peak Area By HPLC ≥ 95% |
Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
Molecular Weight | 4003.8 |
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 | |
Sequence(Three-Letter Code) | H - Lys - Trp - Lys - Leu - Phe - Lys - Lys - Ile - Glu - Lys - Val - Gly - Gln - Asn - Ile - Arg - Asp - Gly - Ile - Ile - Lys - Ala - Gly - Pro - Ala - Val - Ala - Val - Val - Gly - Gln - Ala - Thr - Gln - Ile - Ala - Lys - NH2 |
Product Citations | Yu, G. et al. (2016). Combination effects of antimicrobial peptides Antimicrob Agents Chemother doi: 10.1128/AAC02434-15.McGrath, D. et al. (2013). Mechanism of action and initial evaluation of a membrane active all-D-enantiomer antimicrobial peptidomimetic. PNAS 110, 3477. doi: 10.1073/pnas.1221924110.Kulagina, NV. et al. (2007). Antimicrobial peptides as new recognition molecules for screening challenging species. Sens Actuators B Chem. 121, 150. doi: 10.1016/j.snb.2006.09.044. |