Product Name | Nesfatin - 1 (24 - 53), mouse |
Size | 0.5 mg |
Catalog # | AS-65572 |
US$ | $194 |
Nesfatin-1 was recently identified as anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 was linked to the anxiety and stress. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | 20°C |
References | 1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013) 2. Vas S., et.al., PLOS 8 (4), 1-10 (2013) 3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010) |
Molecular Weight | 3672.3 |
PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2 | |
Sequence(Three-Letter Code) | Pro - Asp - Thr - Gly - Leu - Tyr - Tyr - Asp - Glu - Tyr - Leu - Lys - Gln - Val - Ile - Glu - Val - Leu - Glu - Thr - Asp - Pro - His - Phe - Arg - Glu - Lys - Leu - Gln - Lys - NH2 |