

Product Name | Adrenomedullin (1 - 50), ratYRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY - NH2 (Disulfide bridge: 14 - 19) |
Size | 0.5 mg |
Catalog # | AS-60454 |
US$ | $345 |
Purity | % Peak Area By HPLC ≥ 95% |
Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature. | |
Detailed Information | ![]() ![]() |
Storage | -20°C |
References | Ref: Belloni, AS. et al. Life Sci. 63, 2313 (1998); Sone, M. et al. Peptides 18, 1125 (1997). |
Molecular Weight | 5729.5 |
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19) | |
Sequence(Three-Letter Code) | H - Tyr - Arg - Gln - Ser - Met - Asn - Gln - Gly - Ser - Arg - Ser - Thr - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Met - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Gly - Met - Ala - Pro - Arg - Asn - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 (Disulfide bridge: 14 - 19) |