Product Name | Gastrin Releasing Peptide, humanVPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2 |
Size | 0.5 mg |
Catalog # | AS-24213 |
US$ | $118 |
Purity | % Peak Area By HPLC ≥ 95% |
Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells. | |
Detailed Information | Material Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11.7.1267Taché, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994)Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x. |
Molecular Weight | 2859.4 |
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 | |
Sequence(Three-Letter Code) | H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2 |