Product Name | Cecropin BKWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2 |
Size | 0.5 mg |
Catalog # | AS-24011 |
US$ | $181 |
Purity | % Peak Area By HPLC ≥ 95% |
Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004). |
Molecular Weight | 3834.7 |
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 | |
Sequence(Three-Letter Code) | H - Lys - Trp - Lys - Val - Phe - Lys - Lys - Ile - Glu - Lys - Met - Gly - Arg - Asn - Ile - Arg - Asn - Gly - Ile - Val - Lys - Ala - Gly - Pro - Ala - Ile - Ala - Val - Leu - Gly - Glu - Ala - Lys - Ala - Leu - NH2 |
Product Citations | Kulagina, NV. et al. Sens Actuators B Chem. 121, 150 (2007). |