Product Name | Chlorotoxin (Cltx) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35) |
Size | 0.1 mg |
Catalog # | AS-60770 |
US$ | $118 |
Purity | % Peak Area By HPLC ≥ 95% |
A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom. | |
Detailed Information | DatasheetMaterial Safety Data Sheets (MSDS) |
Storage | -20°C |
References | Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993). |
Molecular Weight | 3996 |
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) | |
Sequence(Three-Letter Code) | H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35) |
Product Citations | Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.Meng, X. et al. (2007). Specific targeting of gliomas with multifunctional superparamagnetic iron oxide nanoparticle optical and magnetic resonance imaging contrast agents.Acta Pharmacol. Sinica 28, 2019. |