| Predicted Species Reactivity | Human |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMC5 |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVE |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-SMC5 (ARP75443_P050) antibody is Catalog # AAP75443 |
| Datasheets/Manuals | Printable datasheet for anti-SMC5 (ARP75443_P050) antibody |
| Gene Symbol | SMC5 |
|---|---|
| Official Gene Full Name | structural maintenance of chromosomes 5 |
| Alias Symbols | SMC5L1 |
| NCBI Gene Id | 23137 |
| Protein Name | Structural maintenance of chromosomes protein 5 |
| Description of Target | Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6. SMC5-SMC6 complex may prevent transcription of episomal DNA, such as circular viral DNA genome. |
| Swissprot Id | Q8IY18 |
| Protein Accession # | NP_055925.2 |
| Nucleotide Accession # | NM_015110.4 |
| Protein Size (# AA) | 1101 |
| Molecular Weight | 121 kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express SMC5.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express SMC5.  |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
How long will it take to receive "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "SMC5 Antibody - C-terminal region (ARP75443_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
This target may also be called "SMC5L1" in publications.
What is the shipping cost for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "121 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "SMC5 Antibody - C-terminal region (ARP75443_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "SMC5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "SMC5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "SMC5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "SMC5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "SMC5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "SMC5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
