| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human FOXO4 |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: AIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHS |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-FOXO4 (ARP84185_P050) antibody is Catalog # AAP84185 |
| Datasheets/Manuals | Printable datasheet for anti-FOXO4 (ARP84185_P050) antibody |
| Gene Symbol | FOXO4 |
|---|---|
| Official Gene Full Name | forkhead box O4 |
| Alias Symbols | AFX, AFX1, MLLT7 |
| NCBI Gene Id | 4303 |
| Protein Name | forkhead box protein O4 |
| Description of Target | This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation involving this gene on chromosome X and the homolog of the Drosophila trithorax gene, encoding a DNA binding protein, located on chromosome 11 is associated with leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Swissprot Id | P98177 |
| Protein Accession # | NP_001164402.1 |
| Nucleotide Accession # | NM_001170931.1 |
| Protein Size (# AA) | 505 |
| Molecular Weight | 55 kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express FOXO4.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express FOXO4.  |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
- IHC Tips & Tricks
- ICC Tips & Tricks
- ELISA Tips & Tricks
- WB/IB Tips & Tricks
- IP Tips & Tricks
See our General FAQ page.
What is the species homology for "FOXO4 Antibody - middle region (ARP84185_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
How long will it take to receive "FOXO4 Antibody - middle region (ARP84185_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
What buffer format is "FOXO4 Antibody - middle region (ARP84185_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".Additional format options may be available. For more information please contact info@avivasysbio.com.
What are other names for "FOXO4 Antibody - middle region (ARP84185_P050)"?
This target may also be called "AFX, AFX1, MLLT7" in publications.
What is the shipping cost for "FOXO4 Antibody - middle region (ARP84185_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
What is the guarantee for "FOXO4 Antibody - middle region (ARP84185_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
Can I get bulk pricing for "FOXO4 Antibody - middle region (ARP84185_P050)"?
You can get bulk pricing for this item by going here.
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "55 kDa".Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.
What protocols are available for "FOXO4 Antibody - middle region (ARP84185_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
What are positive controls for "FOXO4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What are negative controls for "FOXO4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
What other proteins interact with "FOXO4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
What biological processes are associated with "FOXO4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
What cellular components are associated with "FOXO4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
What protein functions are associated with "FOXO4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
