| Clone | 158A3 |
| Isotype | IgG2a |
| Product Type | Primary Antibodies |
| Units | 0.1 mg |
| Host | Mouse |
| Species reactivity | CanineHuman |
| Application | ImmunocytochemistryImmunohistochemistry (frozen)Western Blotting |
BackgroundIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
Source158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
ProductEach vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Formulation: Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Specificity158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A.
Applications158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration.
StorageThe antibody is shipped at ambient temperature and may be stored at +4°C. For prolonged storage prepare appropriate aliquots and store at or below -20°C. Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2). Repeated thawing and freezing should be avoided. Working dilutions should be stored at +4°C, not refrozen, and preferably used the same day. If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance or the concentration of the product.
CautionThis product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. It may contain hazardous ingredients. Please refer to the Safety Data Sheets (SDS) for additional information and proper handling procedures. Dispose product remainders according to local regulations.This datasheet is as accurate as reasonably achievable, but Exalpha Biologicals accepts no liability for any inaccuracies or omissions in this information.
References1. Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. 2. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
Safety Datasheet(s) for this product:EA_Sodium Azide/wp-content/uploads/SDS/Antibody SDS with Sodium AzideV2.pdf


