Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GUCY2C. Source: E.coli Amino Acid Sequence: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | GUCY2C |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This peptide is useful as a blocking peptide for NBP1-81788.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW | 27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |